Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021781-GRMZM2G071745
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Cytochrome b5

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.217247041399
Log2 mRNA fold difference:2.5353321375001
Log2 TE fold difference:-1.2630528002439
Sequences
Protein sequence

YPVSHPAPPTCSSAARQQSRAVCLYVSCYRSCLVVFLGKPRRSLPPRIIYSRHPCHRRFD
LVDTEGSREGAEMPTLTKLYSMEEAALHNTPDDCWVIVDGKIYDVTKYLEDHPGGADVLL
EATGKDATVQFDDAGHSKSAKDNESS*

MPTLTKLYSMKEAALHNTPDDCWVVVDGKIYDVTKYLEDHPGGADVLLEATGKDATEEFD
DAGHSKSAKELMQDYFVGELDSDPTPEIPEMEVFRKEQDTGFARKLMDDVVQYWSIPAAV
IGISAVVAILYARRK*

Other information
Ka divergence:-0.786178KaKs divergence:-0.815146
GC content 1 (%):56GC content 2 (%):52GC content divergence:-0.037
Length 1 (bp):441Length 2 (bp):408Length divergence:-0.039
MFE 1 (kcal):-162.92MFE 2 (kcal):-139.4MFE divergence-0.078