Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021794-GRMZM2G001514
Species:maize
Duplication type:WGD
Function (paralog1):fasciclin-like arabinogalactan protein 7
Function (paralog2):LOC100283035

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAGSASRLAILLVLLAASPLLGATQKAAPGPASSSGSGAGAADAAPPTDVNKALKDEQFS
EFRQLLHDTRVDTQINAQLTDSYNGLTIMAPTNAAFDKMKAGVLNGLSPQEQIQMVLYCV
LPRFYSLSMLGTLSGKVNTQGSGHDGPYRYDIKRSGNNVNVSTGVNWMLLGSPVSKDFPL
AIYPVDKVPLPYELFGPKPPTPAPAPAPAPGPAKAKTKKKKKSAAIAEPPTADDDDTGST
SDDQKAAAAPPRASRAAAALSVLGAAVLVGGLF*

MATTSTPRLATLLVLLAAASPLLSAAQKAAPKAPAAAKAAPGPAASSSSGAGAADAAPPT
DVNKALKDDQFSEFKQLLHDTRVDTQINAQLTDSYNGLTIMAPTNAAFDKMKAGVLNGLS
PQDQIQLVLYCVLPRFYSLSMLGTLDGKVNTQGSGHDGPYRYDIKRSGNNVNVSTGVNWM
LLGSPVSKDFPLAIYPVDKVPLPYELFGPKPPTPAPAPAPAPAKSKTKKKKKAAGIAEPP
TADDDTSASDDQKAAATPGAAGSWAAAALSALAAAALGAGLF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):822Length 2 (bp):849Length divergence:0.016
MFE 1 (kcal):-411.36MFE 2 (kcal):-405.1MFE divergence-0.008