Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021831-GRMZM2G392168
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274197
Function (paralog2):6b-interacting protein 1 (LOC100285537), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.3549539591402
Log2 mRNA fold difference:0.93225271051978
Log2 TE fold difference:-0.14636043078404
Sequences
Protein sequence

MPGSPSKHDRQPHAAGTAAPPKLTLPKPDRIRSPSPSPTLPSPNSLRSAGTQMDDDDDMS
PSSSPSPPSSALPVDGPVTVAAAPPGATMVVALPIHRTAASLYASAAAAGGGGGGREDAW
SDGATSALIDAWGERFVALGRGSLRHPQWQEVADAVSSRDGYSKGPRSDVQCKNRIDTLK
KYKVERAKPVSAWQFFDRLDFLLAPTYGNKPGSSGGGGGGHNSNSRGQMPSALRVGFPQR
SRTPLMPAAKRRAPSPEPSVSSDGFSPLPALPPAVNGKRKRPDEGRPDGGSGDDRARGLQ
ELAHAIRRLGEAYERVEAAKLEQAAEMERQRMDFAQELESQRVQFFLDAQMELTQARNHV
SPASAARPAAGGSSRRTSVVTDTGGSSNHHSRYRISHGDMHRHAPRSHYQPQYHGNNHAG
AGAGAGAASEEEDDYEEES*

MDDDDDVSPSSSPSPPSSSALPVDGPVTVAAAPPGASMAVALPIHRTAASLYASAGGDGG
GGGGREDAWSDGATSALIDAWGERFVALGRGSLRHPQWQEVAEAVSSRDGYSKAPKSDIQ
CKNRIDTLKKKYKVERIKPVSGWQFFDRLDFLLAPTYGNKPGNGGGGHNSNSRSQMPAAP
RVGFPQRSRTPLMPAAGSGAKRRAPSPEPSVSSDSSDGFPPMPALPAVNGKRKRTDDGRS
DGGGDRAQGLRELAQAIRRLGEAYERVEATKLEQEAEMERRRMDFAQELESQRVRFFLDT
QMELTQAKNHASPATAAVPAVGSSRRIPRMSLVTDAGGSSNHHSRYRISHVDRHRHAPRP
HYQQYHDNNNAGAAAASDGEQSDEEDYEEESQ*

Other information
Ka divergence:-0.135375KaKs divergence:0.299149
GC content 1 (%):70GC content 2 (%):68GC content divergence:-0.014
Length 1 (bp):1320Length 2 (bp):1179Length divergence:-0.056
MFE 1 (kcal):-658.63MFE 2 (kcal):-574.83MFE divergence-0.068