Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021881-GRMZM2G130764
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381807
Function (paralog2):hypothetical protein LOC100277380

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.51572999731176
Log2 mRNA fold difference:2.2061373795701
Log2 TE fold difference:-1.7753634403718
Sequences
Protein sequence

MSSMWRVSRRLLRAAASASTSAIGRGAEPRRWVPPPFALQRCGHASLPDAARRDGEEEVT
AAEARRLMRLTNVDALKRRLGDGEVIPYADLLRACQDSGAARTRAEAAALAGALDEAGVV
LLFRDRVYLQPDKIVDLVRKAMPLALTPENDVGKEELKQLQVQLEDINKLAHKQVRRILW
SGLGFLITQVGLFFRLTFWEFSWDVMEPITFFTTTTGLIVGYAYFLITSRDPTYRDFMER
MFESRQRKLIERQNFNLDKYLELQRRCKDPLEKACGTTNTDMAHLHELSIHK*

MSMWRVSRSLLRAASAVGRGAAPSRWVPQPCALQRCGYALLPEAARRDGEEEVTAAEARR
LMRLANVEALKRRLGNGEVIPYADLLRACQDSGAARTRAEAAALAAALDEAGVVLLFRDR
VYLHPDKIVDLVRKAMPLALTPENDPGKEELKQLQVQLEDINKLAHKQVRRILWSGLGFL
ITQVGLFFRLTFWEFSWDVMEPITFFTTTTGLVVGYAYFLITSRDPTYRDFMERMFESRQ
RKLIQRQNFNLDKYLELQRRCKDPLEKACGTTNPDTAHLHELSVHK*

Other information
Ka divergence:-0.355968KaKs divergence:-0.104585
GC content 1 (%):64GC content 2 (%):64GC content divergence:0
Length 1 (bp):879Length 2 (bp):861Length divergence:-0.01
MFE 1 (kcal):-423.7MFE 2 (kcal):-412.4MFE divergence-0.014