Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021973-GRMZM2G041424
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100278242
Function (paralog2):hypothetical protein LOC100275813

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.0060310664404
Log2 mRNA fold difference:2.3766069080116
Log2 TE fold difference:-1.7878603353507
Sequences
Protein sequence

MEAAFLLGPYTGGSGLGGRVHARSGGRRSAAAVKRLLLRLRRSWRRRAARPRRTAVRFGY
DPHSYSQNFDDGTASCGHHRL*

MAAASLLGPYTGGSGLGGRLVHARSGGRRPAAAVKRLLSRLRRSWRRRAARPRRTAVRFG
YDLHSYYQNFDDGTASCAHHRL*

Other information
Ka divergence:-0.0272794KaKs divergence:-0.0268041
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):246Length 2 (bp):249Length divergence:0.006
MFE 1 (kcal):-117.2MFE 2 (kcal):-121.3MFE divergence0.017