Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022052-GRMZM2G093908
Species:maize
Duplication type:WGD
Function (paralog1):transcription initiation factor TFIID subunit 11
Function (paralog2):transcription initiation factor TFIID subunit 11 (LOC100285251), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.9048596016291
Log2 mRNA fold difference:1.2133902315244
Log2 TE fold difference:-0.34295042524219
Sequences
Protein sequence

MKDPFEAAVEEQDSPPDSPAPPEEEPGAAGLADDAEDYDGGPPPRQPSAPASHAASAAAK
AKGRVQREQQEDDDDDEDQMEVDLDKLPSSTGDPDKLAKMNAILSQFTQQQMNRYESFRR
SGFQKSNMKRLLASITGSQKISIPTSIVVSGIAKIFVGELIETARVVMSERKDSGPIRPC
HIREAYRRLKLEGKIPRRSVPRLFR*

MKDPFEADVEEQDSPPESPAPPEDEPGAAGPAEDPEDYDGGPPPRQPSAPASHAAGAKAK
ARVHREQQEDDDEDEDQIEVDLEKLPSSTGDPDKLAKMNAILSQFTQQQMNRYESFRRSG
FQKSNMKRLLASITGSQKISIPTSIVVSGIAKIFVGELIETARVVMSERKDSGPIRPCHI
REAYRRLKLERDDPTAICS*

Other information
Ka divergence:0.639866KaKs divergence:0.13678
GC content 1 (%):58GC content 2 (%):57GC content divergence:-0.009
Length 1 (bp):618Length 2 (bp):600Length divergence:-0.015
MFE 1 (kcal):-236.6MFE 2 (kcal):-219.8MFE divergence-0.037