Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022090-GRMZM2G081653
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100274051

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.47376610548226
Log2 mRNA fold difference:-0.91477443097923
Log2 TE fold difference:0.46834089237148
Sequences
Protein sequence

MQELLAIQQQGPRAIGFFGTRNMGFMHQQLIEILSYAMVITKNHIFTSGASGTNAAVIRG
ALRAEKPELLTVILPQSLKKQPPESQELLSKVQNLIEKPQHDHLPLIEASRLCNMDIISK
VQQVICFAFHDSKLLMETCQEAKNLRKIVTLFYLD*

MTMAGSCAAVPVAGLPSLRTPMPTHLRLGGFMPCSSAARSRGAAVLGCALGARKQTPGVL
NQLLCRYMRRDGHEGDVSNQGRDGAVMFGPDDDGVKIPTQVETLVKGTAAVAEPEYKQIP
DVDYLQELLAIQQQGPRAIGFFGTRNMGFMHQQLIEILSYAMVITKNHIFTSGASGTNAA
VIRGALRAEKPELLTVILPQSLKKQPPESQELLSKVQNLLEKPQYDHLPLIEASRLCNMD
IISKVQQVICFAFHDSKLLMETCQEAMNLRKIVTLFYLD*

Other information
Ka divergence:0.00657132KaKs divergence:0.291387
GC content 1 (%):44GC content 2 (%):49GC content divergence:0.054
Length 1 (bp):468Length 2 (bp):840Length divergence:0.284
MFE 1 (kcal):-132.8MFE 2 (kcal):-284.9MFE divergence0.364