Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022248-GRMZM2G013695
Species:maize
Duplication type:WGD
Function (paralog1):Grx_S14 - glutaredoxin subgroup II
Function (paralog2):Grx_S14 - glutaredoxin subgroup II

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAASATAARPLAGTAVPLPLSTRTRPARVALLSLIPPAPAQRLALRRGAWLSPPERSRSV
RCLAAMSPEMRATLDKVVGSSKVVLFMKGTKDFPQCGFSHTVVQILRSLDVPFETLDVLA
NEALRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQETLEKAMCS*

MAASAPAVRPLARAAIPIPLSARPRTARVSLLPLAPLAPAQRLALGRTGQARLPARSRSV
RCLAALSPEMRETLDKVVGSSKVLLFMKGTKDFPQCGFSHTVVQILRSLDVPFETLDVLA
NEALRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQETLEKAMCS*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):519Length 2 (bp):519Length divergence:0
MFE 1 (kcal):-227.7MFE 2 (kcal):-237.1MFE divergence0.02