Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022269-GRMZM2G313678
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273405 (LOC100273405), mRNA
Function (paralog2):hypothetical protein LOC100194026

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.92509965495192
Log2 mRNA fold difference:-1.8449866789534
Log2 TE fold difference:0.94566541910717
Sequences
Protein sequence

MASAAVLRNAGSRRLFSYPTLRAAAIYVPSALPDAPAAAAAPAQPPPTAGTLWARSMATF
TRTKPHVNVGTIGHVDHGKTTLTAAITKVLAEAGKAKAVAFDEIDKAPEEKARGITIATA
HVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMPQTKEHILLARQV
GVPSLVCFLNKVDAVDDPELLELVEMELRELLSFYKFPGDEIPIIRGSALSALQGNNDEI
GKNAILKLMDAVDEYIPDPVRQLDKPFLMPIEDVFSIQGRGTVVTGRVEQGTIKTGEDVE
ILGLAQTGPLKTTVTGVEMFKKILDHGEAGDNVGLLLRGLKRGDVERGQVVCKPGSLKTC
KKFEAEIYVLTKDEGGRHTAFVTNYSPQFYFRTADVTGRVELLGEMKMVLPGDNVTANFE
LISPVPLEPGQRFAIREGGRTVGAGVVSKVLS*

MASTVVLRNACSRRLFCYSTLRAAAILGPAAPPDAPAAASAQPPPMAGTLWARSMATFTR
TKPHVNVGTIGHVDHGKTTLTAAITKVLAEAGKAKAVAFDEIDKAPEERARGITIATAHV
EYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMPQTKEHILLARQVGV
PSLVCFLNKVDAVDDPELLELVEMELRELLSFYKFPGDEIPIIRGSALSALQGNNDEIGK
NAILKLMDAVDEYIPDPVRQLDKAFLMPIEDVFSIQGRGTVVTGRVEQGTIKTGEDVEIL
GLTQSGPLKTTVTGVEMFKKILDHGEAGDNVGLLLRGLKRGDVERGQVVCKPGSLKTYKK
FEAEIYVLTKDEGGRHTAFVTNYTPQFYFRTADVTGKVELLGETKMVLPGDNVTANFELI
SPVPLETGQRFAMREGGRTVGAGVVSKVIS*

Other information
Ka divergence:0.0830603KaKs divergence:0.123026
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):1359Length 2 (bp):1353Length divergence:-0.002
MFE 1 (kcal):-510.28MFE 2 (kcal):-499.5MFE divergence-0.011