Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022279-GRMZM2G117754
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273015
Function (paralog2):alpha-L-fucosidase 2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.3554930477525
Log2 mRNA fold difference:-0.22237420216792
Log2 TE fold difference:1.4976188919025
Sequences
Protein sequence

MSTATAPSPSPSPSPSSGTRPLLRIGAARRFAMAFPPWAALLFAGVLVVVLAAAGAEAGG
GSVCFDRMFSFGDSLTDTGNFLLSVPDDFPDPARNLPYGQTFFGRPSGRYSDGRNLLDFF
AEAFGLPYVPPYLGGGDFQNGANFAVGGATALNGSFFRERGVEPTWTPHSLDEQMQWFKK
LLTSIAPLETEQNKIISKSLFFVGEVGGNDYNHLIVRDKSVDELHEVVPNVVGAISSAIT
DLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNDFAEYHNKMLQEE
LEKLRNLHPDVTIIYADYYGAALNIFRAPLQFGFTVPLNACCGSDAPYNCSPSILCGRPG
STVCPDPSKYISWDGLHFTEASYKVVIQGVLGGYAKPPLSETCKGAEFKVSQLHQCTDNP
TNTVSYDALSSFI*

MPTPTPPSPSPSPSSGTCPLLRIGAGRRFAMAFPSWATLFFAGMMVVLAAVEAEAEAGGG
SVCFDRMFGFGDSLTDTGNFLLSVPDDFPDPARNLPYGQTFFGRPSGRYSDGRNLLDFFA
EAFGLPYVPPYLGSGDFQNGANFAVGGATALNGSFFRERGVEPTWTPHSLDEQMQWFKKL
LPFIAPSETELNEIMSKSLLFVGEIGGNDYNHLIVREKSVDELHEIVPNVVGAISSGITD
LINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYHNRMLQEEL
EKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPSILCGRPGS
TVCPDPSKYISWDGLHFTEASYKVVIQGVLGGYAKPPLSEACKGAEFKVSQLHQCTDNPT
NTVSYDALSSFI*

Other information
Ka divergence:0.311989KaKs divergence:0.0688705
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):1302Length 2 (bp):1299Length divergence:-0.001
MFE 1 (kcal):-461.96MFE 2 (kcal):-449.8MFE divergence-0.013