Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022368-GRMZM2G132577
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276175
Function (paralog2):hypothetical protein LOC100275329

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.6715666190461
Log2 mRNA fold difference:4.9853183109394
Log2 TE fold difference:-2.3016551954085
Sequences
Protein sequence

MDRSKSYAGGRMQIEPYYGGGGGGGGGARADFRSYSYSAGGTGPSSYSYNQYEYGGPGAG
EEEVKRSKSKRRWLADPDMDRKRRVAAYKAYGVEGRVKGSLRKSFRWVKDRYLDLVYGWS
*

MDRSKSYAGGRMQIEPYYDGGGARPDFRSYSYSAGGSGMGTSSYAYQYEYGGAGAGAGEE
MKRSKSKRRWLALADPDMERKRRVAAYKAYGVEGKMKGSFRKSFKWIKDRYLNLVYGWS*

Other information
Ka divergence:-0.184159KaKs divergence:-0.0273723
GC content 1 (%):69GC content 2 (%):67GC content divergence:-0.015
Length 1 (bp):363Length 2 (bp):360Length divergence:-0.004
MFE 1 (kcal):-173MFE 2 (kcal):-156.92MFE divergence-0.049