Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022383-GRMZM2G425377
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100217300

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.36787382627625
Log2 mRNA fold difference:1.6810099699268
Log2 TE fold difference:-1.3126750886746
Sequences
Protein sequence

MPVDGGIPNSFGGAEQTAKKRKKPGSSSGRANSSGTANTAGPSPSSAPSTPSTHTPGDAM
SVPQLQQNGGSAKPMVMFGSDGTGSLTSPANPLDDVDRLLEDGSLDDNVESFLSQDDMDP
RDNLGRCMDASKGFGFSEVAKARASAAKVVCCHFSADGKLLATGGHDKKVTLWCTDSLKP
KSFLEEHSFLITDVRFSPSMSRLATSSFDKTVRVWDADNTDYSLRTFTGHSASVMSLDFH
PNKEDMICSCDGDGEVRSWSINNGSCLTCVKVFKAGATQMRFQPRKGKYLAAASEKAIYI
LDGETQHACRSPLQGHNKNIQSLCWDSAGEYLASVSEDSVRIWSFSSGRDGEFVHELNRS
GNQFHSCVFHPTYQSLLVIGCYESLELWDIREKNTMTFNNAHDGLVAALAASSATGKVAS
VSHDRTLKLWK*

MLTPQQQQQLMLHAQQNMSSPTSSDVDNRRLRMMLNRNAVLGRDGQTNSGSDIIPNIGSP
SQSGGDIDMLIKKKLAQQQQLLQQQSNSQQLPQQHQLQQPAVSSQQSQSSNQHLQQEKPG
IGSMPADGGIPNSFGGAEQTAKKRKKPGSSSGRANSSGTANTAGPSPSSAPSTPSTHTPG
DVMSVPQLQQNGGSAKPMVMFGSDGTGSLTSPANPLDDVDRLLEDGSLDDNVESFLSQDD
MDPRDNLGRCMDASKGFGFSEVAKARASTAKVVCCHFSADGKLLATGGHDKKVTLWCTDS
LNPKSYLEEHSFLITDVRFSPSMSRLATSSFDKTVRVWDADNTDYSLRTFTGHSATVMSL
DFHPNKEDMICSCDSDGEVRSWSINNGSCLTCVKVFKGGATQMRFQPRKGKYLAAASDKA
IYILDGETQHACRSPLQGHNKNIQSLCWDSAGEYLASVSEDSVRIWSFSSGREGEFVHEL
NRSGNQFHSCVFHPTYQSLLVIGCYESLELWDIREKNTMTFNNAHDGLVAALASSSATGK
VASVSHDRTLKLWK*

Other information
Ka divergence:0.453317KaKs divergence:0.493797
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1296Length 2 (bp):1665Length divergence:0.125
MFE 1 (kcal):-418.6MFE 2 (kcal):-521.58MFE divergence0.11