Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022563-GRMZM2G003190
Species:maize
Duplication type:WGD
Function (paralog1):LOC100280714
Function (paralog2):3-oxoacyl-synthase III (LOC100280787), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MVAASGLALPRVSAPCPVRTRGGLRPAFLRVAQPVTLPPPQLRCCASTVDDGVVSAAASK
PRLPRVVGMGSKLVGCGSAIPTLSVSNDDLSKIVETSDEWIAARTGIRNRRVLSGDETLR
GLSIQAAQRALEMAGVKAEDVDLVLLCTSTPDDLFGGAAQVLSEVGCTKAFGFDITAACS
GFLVGLITATRFIKGGGFQNVLVIGADALSKYVDWTDRGTCILFGDAAGAVLVQACSADE
DGMLGFCVQSDGNGQKHLSAIAANDESILSNTNGVPGFPPKKATYSCIQMNGKEVFRFAV
RCVPQSIEKALQEAGLPASSIDWLLLHQANQRIIDAAASRLDIPSDKVISNLANYGNTSA
ASIPLALDEAVRSGKVKTGDIIAASGFGAGLTWGSAIVKWG*

MVAASGLALPRVAAPCPARPRGGLRPALLRFAPPVALPPHQLRCCASTVDDGLVSAAASK
PRLPRVVGMGSKLVGCGSAIPTLGVSNDDLSKIVETSDEWIAARTGIRNRRVLSGDETLR
GLSIKAAQRALEMAKVKAEDVDLVLLCTSTPDDLFGGATQVLTDVGCTKAFGFDITAACS
GFIVGLITATRFIKGGGFQNILVVGADALSKYVDWTDRGTCILFGDAAGAVLVQACSADE
DGLLGFCVQSDGNGQKHLNAATAIDESILSNTMVFLDFRQRRQPTHAFR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):1206Length 2 (bp):870Length divergence:-0.162
MFE 1 (kcal):-431.19MFE 2 (kcal):-320.82MFE divergence-0.147