Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022619-GRMZM2G113720
Species:maize
Duplication type:WGD
Function (paralog1):60S ribosomal protein L18a
Function (paralog2):LOC100286074

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.5174994520872
Log2 mRNA fold difference:-0.11852660133911
Log2 TE fold difference:-0.39844379684367
Sequences
Protein sequence

MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM
LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS
PCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLVYRKVRPPTRKLRTTFKSSRPNLFM*

MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM
LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS
PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM*

Other information
Ka divergence:-1KaKs divergence:-0.975
GC content 1 (%):58GC content 2 (%):56GC content divergence:-0.018
Length 1 (bp):537Length 2 (bp):537Length divergence:0
MFE 1 (kcal):-186.03MFE 2 (kcal):-182.4MFE divergence-0.01