Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022627-GRMZM2G051852
Species:maize
Duplication type:WGD
Function (paralog1):nucleotide binding protein
Function (paralog2):nucleotide binding protein (LOC100285051), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1738132176257
Log2 mRNA fold difference:-1.2579524565548
Log2 TE fold difference:-0.10569783121241
Sequences
Protein sequence

MQLLPRLCMANGTGDGDGKGNANSSKLATAVSSSSSTVSTTSSAATAAAVSEASSSTTSL
PSLSSATGGSVTASLVHVTTLLPPSAPSAAAAVAAAGDSPHGLVVARPACVAFHDLSTLE
ATSTSDAADGAAAAGSVKCVTHLPGGGGTAAVTGHQDGRLRLWRASSRSRARLRLAAALP
TVSDRLRRFPVPSNHVAVRRHHRRLWIEHADAVAGVAASADGRLLFSVSWDRTLKVWAVP
SLRCLQSLAAHDDAVNAVAVAPDGTVYTASADKRVRVWAPDNKPPSRRAARGKRHQQQPV
YHLVATLSRHTAAVNALAVGCGGQALYSGGNDRSVLVWEREDSASHMVAIGALRGHRKAV
LSVACAPGGLVVSGSADQTVRAWRRAADGRGYACVAVIDGHHTAVRSVAAAPVPIQLKRS
RAAGGVDGGDEEWRVCSASFDGEVRVWSLRVSGLFGAIF*

MKLLPRLCMATGTGTGDGDGEGSASSSTKRATAVSSSSSTVSTSSAAAAAVSESSSSTSL
PSLSSATSASLAASFVHVATLLPLSARPSPCAAVVAATGGSLPGLVVARPSCVALHDLST
LEATSTSDAAAGAGAGSVKCVARLPGGGGGGAAVTGHQDGRLRLWRVSSRSPGRIRLAAA
LPTVSDRLRRFPVPSNHVAVRRHHRRLWIEHADAVSGVAASADGRLLFSVSWDKTLKVWA
APSLRCLQSLAAHDDAVNAVAVAPDGTVYTGSADRRVRVWAPRPRPRPAARGKKQPVYHL
VATLSRHTAAVNALAVGRGGQALYSGGNDRCVLVWEREDSASHMAAVGALRGHRKAVLSV
ACAPGGLVVSGSADQTVRAWRRAADGRGYACVAVIDGHGTAVRSVAAAPLPVLQKRSRAG
GVDGGGGDEEWRVCSASFDGQVRVWSLRVSCL*

Other information
Ka divergence:-0.0205238KaKs divergence:-0.199038
GC content 1 (%):74GC content 2 (%):76GC content divergence:0.013
Length 1 (bp):1380Length 2 (bp):1359Length divergence:-0.008
MFE 1 (kcal):-791.1MFE 2 (kcal):-808.3MFE divergence0.011