Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022679-GRMZM2G031724
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.787897617472
Log2 mRNA fold difference:-2.0878108325453
Log2 TE fold difference:0.46488481122436
Sequences
Protein sequence

MVVLAKPPVVDQIPLLRSPGPRDSFSGVPVVDLSSHGAARAIVDACERFGFFKVVNHGVA
AATMDRAESEAVRFFAQAQADKDRAGPAYPFGYGSKRIGLNGDMGWLEYLLLAVDAASLS
DACPVPSSAAFRSALNEYVAAVRKVAARVLEAMAEGLGIADADALSSMVSGAGSDQVFRV
NHYPPCPALQGLGCSTTGFGEHTDPQIISVLRSNGTSGLQIALRDGAQWVSVPSDRDAFF
VNVGDSLQVLTNGRFRSVKHRVVTNSLKSRVSFIYFAGPPLGQRIAPLPQVLAEGEESLY
KEFTWGEYKKAAYKTRLGDNRLAQFEKRSNI*

MVVVLANPPVVDQIPLLRSPGPRDSFSCVPVVDLSGPGAARAIVDACERFGFFKVVNHGV
PAATMDVAESEAVGFFAQAQADKDRAGPRASYPFGYGSKRIGLNGDMGWLEYLLLAVDSA
SLSDACPVPSGAAFRSALNEYVAAVRDVAARVLEAMAEGLGIADAAALSSMVTGAGSDQV
FRVNHYPPCPALQGLGCTATATGFGEHTDPQIISVLRSNGTSGLQVALRDAAQAQQWVSV
PSDRDAFFVNVGDSLQVLTNGRFESVKHRVVTNSLKSRVSFIYFAGPALEQRIAPLAQLL
AEGEESLYREFTWGEYKTAAYKTRLGDNRLAQFQRCSI*

Other information
Ka divergence:0.391616KaKs divergence:0.436131
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):996Length 2 (bp):1017Length divergence:0.01
MFE 1 (kcal):-499.8MFE 2 (kcal):-503.5MFE divergence0.004