Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022859-GRMZM2G090172
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192908
Function (paralog2):LOC100282170

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.548181628572
Log2 mRNA fold difference:0.53136168556637
Log2 TE fold difference:0.037575673674405
Sequences
Protein sequence

MGSEGSSGPVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDIFMRSWTGTIIGPPNTV
HEGRIYQLKLFCDTDYPDKPPTVRFQTRINMTCVNQETGLVEPSLFPMLGKWEREHTMED
ILTSLKREMSTPQNRRLYQPHEGNEDQRVEQKGVSLRCVIM*

MGSEGSSGPVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDIYMRSWTGTIIGPPNTV
HEGRIYQLKLFCDTDYPDKPPTVRFQTRINMTCVNQETGLVEPSLFPMLGKWEREHTMED
ILSSLKREMSTPQNRRLYQPHEEAGKVARYRNQMSMAVSDLLHYAL*

Other information
Ka divergence:0.772465KaKs divergence:0.705114
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):486Length 2 (bp):501Length divergence:0.015
MFE 1 (kcal):-139.2MFE 2 (kcal):-145.6MFE divergence0.022