Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G022866-GRMZM5G825090
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100272476

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-5.2304462521277
Log2 mRNA fold difference:-3.7156817175022
Log2 TE fold difference:-1.539912583264
Sequences
Protein sequence

MAPPAALHHRTPLLLPRRTVALGATATARAARAASLAVRAQPDTTAAAVSTTAPEPTPEF
KPPPGFKAPEPKRFEVKSGQLGSVLGASLAIPLRLGTGVFVLGYSPSLVSASEIPSDQYA
LEFGAWKVKEESKIGQCKRPEKPIEIYEFEGCPFCRKVREMVTVLDLDVLFYPCPKKGPT
FRPKVLEMGGKKQFPYMVDPNTGVAMYESDDIIKYLADTYGDGTVPIMLSLGLLTAITAG
LATLGRIGKGNSYIASKVPPQPIEIWAYEGSPFCKLVRETLVELELPHLLHSCARGSPKR
QEFFKKKGLFQAPYIEDPNTGVQMFESAEIIDYLKATYALYPSS*

MAPPAAPTALHHRTPLLLPRRTVALGATATARAARAASLAVRAQPDTTAAAVSTSAPEPA
PEFKPPPGFKAPEPKRYEVKSGQVGSVLGASLAIPLRLGTGVFVLGYSPSLVSPSEIPSD
QYALEFGAWKVKEESKIGQCKRPEKPIEIYEFEGCPFCRKVREMVTVLDLDVLFYPCPQK
GPTFRPKVLEMGGKKQFPYMVDPNTGVAMYESDDIIKYLADTYGDGTVPIMLSLGLLTAI
TAGLATLGRIGKGNSYIASKVPPQPIEIWACEGSPFCKLVRETLVELELPHLLHSCARGS
PKRQEFFKKKGLFQAPYIEDPNTGVQMFESAEIIDYLKATYALYPSS*

Other information
Ka divergence:0.0873424KaKs divergence:-0.444984
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):1035Length 2 (bp):1044Length divergence:0.004
MFE 1 (kcal):-338.22MFE 2 (kcal):-348.3MFE divergence0.015