Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G023110-GRMZM2G150448
Species:maize
Duplication type:WGD
Function (paralog1):atypical receptor-like kinase MARK
Function (paralog2):atypical receptor-like kinase MARK (LOC100285260), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.590866279941
Log2 mRNA fold difference:-1.216900617823
Log2 TE fold difference:-0.38633770146132
Sequences
Protein sequence

MRSPPPPPWRAGRLHSPLPMLLLFVAALAARAGADDLASDARALLAFRDAVGRRLTWNAS
DVAGACSWTGVSCENGRVAVLRLPGATLSGAVPAGTLGNLTALHTLSLRLNGLSGALPAD
LASAAALRNVFLNGNRLSGGFPQAILALPALVRLSLGGNDLSGPIPAELGSLTHLRVLLL
ENNRFSGEISDVKLPPLQQFNVSFNQLNGSIPASLRSQPRSAFLGTGLCGGPLGPCPGEV
SPSPAPAGQTPSLTPVPSSGGGNGSGSGSGGTIGGNGGESGHKNKKLSGGAIAGIAIGSA
LGAGLLLFLLVCLCRRSGGTRTRSLEMPPPEAPAAAAAAGGRKPPEMTSGAAVAPLTTIG
HPNAPIGQSTSGKKLVFFGSAAAVAPFDLEDLLRASAEVLGKGAFGTTYKAVLESGATVA
VKRLKDVTLSEAEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPMGSLSAVLHG
NVSSGRTPLNWDLRSSIALAAARGVEYIHSTTSTASHGNIKSSNVLLGKSYQARVSENGL
TTLVGPSSSSSRTTGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVD
LPRWVQSVNRSEWGSLVFDMELMRHQTGEEPMAQLVLLAMDCTAQVPEARPSMAHVVMRI
EEIKKSSVTPNIEQVDDQSSRAESEAAPTNPFAT*

MRTGVLGFFSPRTPDARNEETDETTLNLGSFRTGPALATSAAAAMRSPSPPPWRLRRIRF
AFPMLLVVASLAGADDLASDARALVAFRDAVGRRLAWNASDVAGACSWTGVTCEHGRVAV
LRLPGATLSGTVPAGTLGNLTALHTLSLRLNGLSGALPADLSSAAALRNVFLNGNRLSGG
FPQAILALPGLVRLSLGGNDLSGPIPTELGNLTHLRVLLLENNRFSGEISDVKLPPLQQF
NVSFNQLNGSIPASLRSQPRSAFLGTGLCGGPLGPCPGEVPPSPAPAGQTPSPTPVPSGS
GGGGGTNGGSGVENGHKGKKLSGGAIAGIAIGSALGAALLLFLLVCLCRRSGGIRTRSLE
MPPSSPAPAGGRKPPEMTSAAAVAPLTTIGHPNAPIVQSTSGKKLVFFGSAAAVASFKLE
DLLRASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIV
PLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHS
TSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQK
ADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEAGEE
PMAQLVLLALDCVAQVPEARPSMGHVVTRIEEIRKSSLTTNMEEEVDDQSSKAESEVPTN
PFAS*

Other information
Ka divergence:0.332062KaKs divergence:0.11532
GC content 1 (%):62GC content 2 (%):62GC content divergence:0
Length 1 (bp):2085Length 2 (bp):2175Length divergence:0.021
MFE 1 (kcal):-945.74MFE 2 (kcal):-974.69MFE divergence0.015