Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G023204-GRMZM5G802115
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382546 (LOC100382546), mRNA
Function (paralog2):protein kinase KIPK

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.57440244760276
Log2 mRNA fold difference:0.27653772410128
Log2 TE fold difference:-0.80953036128349
Sequences
Protein sequence

MAAVAAPAPPPPRQLSLEDLKVVSVLGRGAKGVVFHVVHAPGELDGEGEGGAAAAAMALK
AVSREAARHKKAASGDGDGHRRIWFERDVLLALRHPLLPSLRGILATDAIVGFAMDRCGG
GDLNSLRRRQTEKMFSDSVIRFYAAELVLALEYLHSLGVVYRDLKPENVLIQDSGHIMLV
DFDLSTRLPAQPQEPDAPATSPKPAPPVAAPSPIRGRARKPAGAALCFPFRTTGSAAKPA
ADSPSPLSTSRTASSSSSSSTATTASSSAASAGARTPAKSNSFVGTEDYVAPEIIAGRGH
DFAVDWWGLGVVLYEMLYGRTPFRGQNRKETFYRVLAKQPELVGEQTPLRDLIARLLEKD
PERRIGARGVKAHPFFGGVDWERILQVARPPFIPAPPQDEDGDEALDVEKVVREVFASKE
GEGGKASPVADGGPVGGDGDGRRDHSKDGDFSVFF*

MTAVATPTPPPPRQLSLEDLKAISVLGRGAKGVVFHVVHAHGEPDGEGEGGAAAAAMALK
AVSREAARHKKAGSGDGDGHRRIWFERDVLLSLRHPLLPSLRGILATEAVVGFAIDRCGG
GDLNSLRRRQTEKMFSDSVIRFFAAELVLALEYLHSLGIVYRDLKPENVLIQDSGHIMLV
DFDLSTRLPAPPQEPDAPVTSPNAKPALPVAAPSPSRGSARKPAGAALCFPFRTAIATKP
AAPATDSRSPLSTSRTASSSSSSSSSTATTASSAASAGGRTPAKSNSFVGTEDYVAPEII
AGRGHDFTVDWWGLGVVLYEMLYGRTPFRGQSRKETFYRVLTKQPELVGEQTPLRDLIAR
LLEKDPEKRIGARGVRAHPFFRGVDWDRILQVARPPFIPTPPPQDEGEDGDGDEALDVEK
VVREVFASNDAEGGKAWPVADGGRVGGDGDCDGRGDQSKDGDFSVFF*

Other information
Ka divergence:0.200443KaKs divergence:0.241517
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1368Length 2 (bp):1404Length divergence:0.013
MFE 1 (kcal):-758.7MFE 2 (kcal):-765.31MFE divergence0.004