Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G023237-GRMZM2G178886
Species:maize
Duplication type:WGD
Function (paralog1):Grx_I1 - glutaredoxin subgroup III
Function (paralog2):LOC100281053

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.40258814978553
Log2 mRNA fold difference:-1.3412563868367
Log2 TE fold difference:0.77763890584538
Sequences
Protein sequence

MYQAIPYSSARAWLMPAAAAEAGVAAVKPEPVATVAEPAAEEERARPDAAAGDDDDGGRA
EVGRAVAERPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADESALAGLVPAGAGAAAG
ALPAVFVGGRLLGGLDRLMAVHISGELVPILKKAGALWL*

MYQAIPYSSARPWLMPAGEAAAVVAVKPEPEPAAAATVAEERARADAAGGTDDDGDGGRA
EVGRAVAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADEAALAGVVPAGAEAAAA
ALPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL*

Other information
Ka divergence:-0.0820876KaKs divergence:-0.0894519
GC content 1 (%):77GC content 2 (%):77GC content divergence:0
Length 1 (bp):480Length 2 (bp):480Length divergence:0
MFE 1 (kcal):-288.3MFE 2 (kcal):-288.2MFE divergence0