Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G023289-GRMZM2G109383
Species:maize
Duplication type:WGD
Function (paralog1):Phosphoglucomutase, cytoplasmic 2 (PGM 2)(EC 5.4.2.2)(Glucose phosphomutase 2)
Function (paralog2):Phosphoglucomutase, cytoplasmic 1 (PGM 1)(EC 5.4.2.2)(Glucose phosphomutase 1)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.12086634657187
Log2 mRNA fold difference:-0.17168075523781
Log2 TE fold difference:0.2921707493019
Sequences
Protein sequence

MIHPLVLSLPFPAIISRPRRHRHHTTTPSLPSHSRSLHHYRLLRFTPLVASCGDRRRIVR
GASATMGLFTVTKKATTPFEGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADQVKG
ATIVVSGDGRYFSKDAVQIITKMAAANGVRRVWVGQNSLMSTPAVSAVIRERIGADGSKA
TGAFILTASHNPGGPTEDFGIKYNMGNGGPAPESVTDKIFSNTTTISEYLISEDLPDVDI
SVVGVTSFSGPEGPFDVDVFDSSVNYIKLMKTIFDFEAIKKLLTSPKFTFCYDALHGVAG
AYAKHIFVEELGADESSLLNCVPKEDFGGGHPDPNLTYAKELVERMGLGKSSSNVEPPEF
GAAADGDADRNMILGKRFFVTPSDSVAIIAANAVQSIPYFASGLKGVARSMPTSAALDVV
AKNLNLKFFEVPTGWKFFGNLMDAGMCSICGEESFGTGSDHIREKDGIWAVLAWLSIIAF
KNKDNLGGDKLVTVEDIVRQHWATYGRHYYTRYDYENVDAGAAKELMANLVSMQSSLSDV
NKLIKEIRSDVSEVVAADEFEYKDPVDGSVSKHQGIRYLFGDGSRLVFRLSGTGSVGATI
RVYIEQYEKDSSKTGRDSQEALAPLVDVALKLSKMQEYTGRSAPTVIT*

MIQHRPLVLSLPSPAIIPPRPRRHRHHTTTPSLPSHSRSLLHHRFLRVTHLVVASRGDQR
RTLRGATMGLFTVTKKATTPFDGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPVDQV
RGATIVVSGDGRYFSKDAVQIITKMAAANGVRRVWVGQNSLMSTPAVSAVIRERVGADGS
KATGAFILTASHNPGGPKEDFGIKYNMGNGGPAPESVTDKIFSNTTTISEYLISEDLPDV
DISVVGVTSFSGPEGPFDVDVFDSSVDYIKLMKTIFDFEAIKKLLTSPKFTFCYDALHGV
AGAYAKHIFVEELGADESSLLNCVPKEDFGGGHPDPNLTYAKELVERMGLGKSSSNVEPP
EFGAAADGDADRNMILGKRFFVTPSDSVAIIAANAVQSIPYFASGLKGVARSMPTSAALD
VVAKNLNLKFFEVPTGWKFFGNLMDAGMCSICGEESFGTGSDHIREKDGIWAVLAWLSII
AFKNKDNLGGDKLVTVEDIVRQHWATYGRHYYTRYDYENVDAGAAKELMANLVSMQSSLS
DVNKLVKEIRSDVSEVVAADEFEYKDPVDGSVSKHQGIRYLFGDGSRLVFRLSGTGSVGA
TIRVYIEQYERDSSKTGRDSQDALAPLVDVALKLSKMQEYTGRSAPTVIT*

Other information
Ka divergence:0.244527KaKs divergence:0.390387
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1947Length 2 (bp):1953Length divergence:0.002
MFE 1 (kcal):-628.65MFE 2 (kcal):-632.14MFE divergence0.003