Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G023711-GRMZM2G441144
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384570 (LOC100384570), mRNA
Function (paralog2):thioredoxin-like 5

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.48674860170762
Log2 mRNA fold difference:-2.878072443123
Log2 TE fold difference:2.404698005268
Sequences
Protein sequence

MALLAPSPRALCVREAAAASPHPHSLATAACSTVGGGVAGRALWLWNGGGTGRRRRERRE
RFRAEAYFWDVSKPVEMEEIDSMEKLDDALRWSVENNQPIIIDWMASWCRKCIYLVPRME
KIAGEYPGVRFYFVDVNKVPQAVVKRGNVTKMPTIQLWKDGEWKAEVIGGHKAWLVMDEV
REMIQKNK*

MALLAPSPRALRVRETAAAALPHSSATAACSTVGGGAARRALWLWDNGGGTGTGRRKEHR
ERVRPEAYCWDVSRPVEMEEIDSIEKLDDALRWSVENNQPVVIDWMAGWCRKCIYLMPRM
EKMAGEYPEVRFYFIDVNKVPQGVVKRGNVTRMPTIQLWKDGEWKAEVIGGHKACLVMDE
VREMIENNK*

Other information
Ka divergence:0.609142KaKs divergence:0.506089
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):567Length 2 (bp):570Length divergence:0.003
MFE 1 (kcal):-229.96MFE 2 (kcal):-230.49MFE divergence0.001