Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024159-GRMZM2G117207
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):protein YIP1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.60369399772032
Log2 mRNA fold difference:0.29950989513202
Log2 TE fold difference:0.35194935682535
Sequences
Protein sequence

MAKEFPVPPVVFTPSTPTHRRYPPQGVGASPPPAFAPPRPSTSSAANPLPFMSFDVSAAA
ASSSSAPPLFAGPIGVAGSGSSFEDEPPLLEELGINTRQIWRKTISILHPLRSADPSLHA
DADLSGPFLFLLSFGLFQLLAGKFHFGIVLGWVTVASLFLYFVFSMLSGGRRGDLDLYRC
VSLVGYCMLPMVIFSAVSLFLPRGGGLIFGVGMAFVIWSARVCTRLLAELASSGDEHRGL
IAYACWLVYMLFSLLVIF*

MAKEFPVPPVVFTPSTPTHRRHPPPGMGVSPPPAFAPPRPSTSSAANPLPFMSFDVSAAA
ASSSSAPPLFAGPIGVGGSGASFEDEPPLLEELGINTRQIWRKTISILHPFRSTDPSLHA
DADLSGPFLFLLSFGLFQLLAGKFHFGIVLGWVTVASLFLYFVFSMLSGGRRGDLDLYRC
VSLVGYCMLPMVIFSAVSLFLPRGGGFIFGVGMAFVIWSTRVCTRLLGELASSGDEHRGL
IAYACWLVYMLFSLLVIF*

www.000webhost.com

Other information
Ka divergence:-0.0928157KaKs divergence:-0.158187
GC content 1 (%):65GC content 2 (%):63GC content divergence:-0.016
Length 1 (bp):777Length 2 (bp):777Length divergence:0
MFE 1 (kcal):-312.93MFE 2 (kcal):-292.86MFE divergence-0.033