Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024264-GRMZM2G133620
Species:maize
Duplication type:WGD
Function (paralog1):multicystatin
Function (paralog2):hypothetical protein LOC100273245

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.0067088734684
Log2 mRNA fold difference:-1.9115502886449
Log2 TE fold difference:-0.078612277301537
Sequences
Protein sequence

MMPRRALLFAAVLLAASAAAVSGFHLGGDESGLVRGVLAALRERAEAEDAARFAVAHYNK
NQGAALEFTRVLKSKRQVVTGTLHDLILEAADAGKKSVYRAKVWVKPWEDFKSVVEFRLV
GDSESEPEPSVASDVSSGQAIAKLSLEADIVQEEARLHTIENDGLSGDFTSSS*

MTMPRRALLFAAVLLAASAAAVSGFHLAGDESGLVRGVLTAVRERAEAEAEDAARFAVAY
HNRNQGAALEFTRVLKSKRQVVTGTLHDLILEAADAGKKSLYRAKVWVKPWEDFKSVVEF
RLAGDSESEPEPSVASDEGSGQGVAKLSLEADIIHEEAHLHTIENDGLSSDFASSA*

Other information
Ka divergence:0.677734KaKs divergence:0.912199
GC content 1 (%):58GC content 2 (%):60GC content divergence:0.017
Length 1 (bp):522Length 2 (bp):531Length divergence:0.009
MFE 1 (kcal):-210.07MFE 2 (kcal):-225.6MFE divergence0.036