Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024348-GRMZM2G075092
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.056552229658994
Log2 mRNA fold difference:0.32517976091646
Log2 TE fold difference:-0.37487011504033
Sequences
Protein sequence

MSLPAATAPSSSGATQPTEQQGGSRERRVESLGWLTESAVMPKKHKAIEGVGAASILDLK
AQLYRTQEEARNPTAPGAAASGGEFRRAKIRSAPTDPLGAKNSGVESRAHKDKLELKAVK
DGSASYAALEKKAELYEKLYRGELPDEEDKEKYCVDFFQKSSDRIYEPQMPEISHRATDA
AEPVNDHEDSMPNAKPLGLGRAGTTIDRDEHKRFVREVHEEVTEARQKASTVRSRRQEQD
AARREKLRQAYLKKRLEKLIAEKQASSASDDLPS*

MSLPSATAPSSSGATQPLPTEQQGVSRERRMESLGWLTESAVMPKKHKAIEGVGAASILD
LKAQLYRTQEEARNPIAPSAVAAAASGGEFRRAKIRSAPTDPLGAKNSGVESRAHKDKLE
LKAVKDGSESYAALEKKAELYEKLSRGELPDEEDKEKYCVDFFQKGFDRVYEPQIPECSH
RATDGAEPVNDREDSMPNAKPLGLGRAGTTIDRDEHKRFVREVHEEVTEARQKASTVRSR
RQEQDAARREKLRQAYLKKRLEKLIAEKQASSTSD*

Other information
Ka divergence:0.398909KaKs divergence:-0.452947
GC content 1 (%):56GC content 2 (%):55GC content divergence:-0.009
Length 1 (bp):825Length 2 (bp):828Length divergence:0.002
MFE 1 (kcal):-299MFE 2 (kcal):-299.14MFE divergence0