Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024484-GRMZM2G040209
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273176
Function (paralog2):NADH-ubiquinone oxidoreductase 51 kDa subunit

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0051762427444
Log2 mRNA fold difference:-1.0281402262608
Log2 TE fold difference:0.017592181626339
Sequences
Protein sequence

MALRRALLRSAEISFERKAAIEYIHSLSRAQPARSLNGAGLCPASRSLSTQAATTSSTPQ
PPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNE
MKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLL
EGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQEAYAAGLLGKNACGSGYDFDVHIHF
GAGAYICGEETALLESLEGKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGP
EWFASFGRKNNSGTKLYCISGHVNKPCTVEEEMSIPLKELLERHCGGVRGGWDNLLAVIP
GGSSVPLLPKHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESC
GQCTPCREGTPWLWMIMERLKVGDAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLI
RHFRPELERRIRERAERELLAASA*

MALRRALLRSVNFSPDSKAAIEYFYSFSRAQSACSLNGAGLCPASRSFSTQAATTSSTPQ
PPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAVKRGDWYRTKDLVIKGADWIVNE
MKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRQDPHKLL
EGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQEAYAAGLLGKNACGSGYDFDVHIHF
GAGAYICGEETALLESLEGKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGP
EWFASFGRKNNSGTKLYCISGHVNKPCTVEEEMSIPLKELLERHCGGVRGGWDNLLAVIP
GGSSVPLLPKHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESC
GQCTPCREGTPWLWMIMERLKVGDAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLI
RHFRPELERRIRERAERELLAASA*

Other information
Ka divergence:0.337411KaKs divergence:0.166322
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):1515Length 2 (bp):1515Length divergence:0
MFE 1 (kcal):-558.62MFE 2 (kcal):-552.54MFE divergence-0.005