Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024530-GRMZM2G116785
Species:maize
Duplication type:WGD
Function (paralog1):bHLH transcription factor PTF1
Function (paralog2):hypothetical protein LOC100192577

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.41495460476648
Log2 mRNA fold difference:0.12556077102254
Log2 TE fold difference:-0.52879555552409
Sequences
Protein sequence

MDFSAGSYFTSWPVNSASESYSLADGSVESYGGEGIMPPSSYFMTARSDHNLKFSVHEQD
STMLPNDQLTYAGARQTDLLPGETPSRDKLCENLLELQRLQNNSSLPSNLVPPGVLQHNS
TPGAFHPQLNTPGLSELPHALSSSIDSNGSEVSAFLADLNAVSSASALCSTFQNASSFME
PVNLEAFSFQGAQSDSVLNKTTHPNGNISVFDSAALASLHDSKEFISGRLPSFASVQETN
VAASGFKTQKQEQNAVCNVPIPTFTARNQIAVAAMPGSLIPQKIPSWINENKSEGPVSHP
SDVQIQPNSVGNGVGVKPRVRARRGQATDPHSIAERLRREKISDRMKNLQDLVPNSNKAD
KASMLDEIIDHVKFLQLQVKVLSMSRLGAPGAVLPLLAESQTEGYRGQLLSAPTNAQGLL
DTEESEDTFAFEEEVVKLMETSITSAMQYLQNKGLCLMPVALASAISTQKGVSAASIPPE
Q*

MDFSAGSYFSSWPINSASESYSLADGSAESYGEGSMPPSTYFMTARSDHNLNFSVHEQDS
TMLPNEQLTYAGAGQIDLLPAETLSRDKLPENLLELQGLQNISNLQSNLVAPGVFQHNLT
PGVFHPQLNTPGLSELPHALSSSIDSNGSEVSAFLADLNAVSSAPTLCSTFQNASSFMEP
VNLEAFSIQGAQSDCVLNRTSHPNGNISVCDSAALASLHDSKEFISGSLPSFASVQETNL
AASGFKTQKQEQNAVCNIPTFTARNQMSVAAMQGALVPQKIPSRINDNKSEGPVSHPSDV
QTQPNSAVNGVGVKPRVRARRGQATDPHSIAERLRREKISDRMKNLQDLVPNSNKADKAS
MLDEIIDYVKFLQLQVKVLSMSRVGAPGAVLPLLTESKTEGYHGQPLPQGLLDALDSEDS
FVFEEEVVKLMETSITSAMQYLQSKGLCLMPVALASAISTQKGVSAAAVPPER*

Other information
Ka divergence:0.104409KaKs divergence:0.0254989
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1446Length 2 (bp):1422Length divergence:-0.008
MFE 1 (kcal):-440.44MFE 2 (kcal):-442.43MFE divergence0.002