Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024615-GRMZM2G050658
Species:maize
Duplication type:WGD
Function (paralog1):lipid phosphate phosphatase 3
Function (paralog2):hypothetical protein LOC100273231

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.67054182459413
Log2 mRNA fold difference:1.3909965544024
Log2 TE fold difference:-0.7283174218558
Sequences
Protein sequence

MSPLSLSLSLSLSLLLLPTVSVSWLIHSRILVGDDEAPIRSGAEGDIEEPLVSRRTETMA
DQLGSYTIRSHGMILARLHMYDWIILLLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPMKG
NTVPFWAVPLIGIILPWAIFVGIYFKKNNFYDLHHGILGILYSVLITAVITDAIKDGVGR
PRPDFFWRCFPDGNDVYDNITTGVICNGVKSVIKEGHKSFPSGHTSWSFAGLGFLAWYLA
GKLTAFDRKGHIRKLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGGLIGLTVASFCYLQ
FFPYPFDGDALWPHAYTVQLAEEGSSRNTNSYSVRPAEIETVNIPGHGGITLRDTLNDME
SGSGRRL*

MADQLGSYTIRSHGMILARLHMYDWIILLLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPM
KGNTVPFWAVPLIGIILPWAIFVGIYFKKKNFYDLHHGILGILYSVLITAVITDAIKDGV
GRPRPDFFWRCFPNGNDVYDNITTGVICNGVKSVIKEGHKSFPSGHSSWSFAGLGFLAWY
LAGKLTAFDRKGHIAKLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGGLIGLTVASFCY
LQFFPYPFDGDALWPHAYAVRLAEEGNSRNANSYSVRPTEIETVDIPGHGGIITLRDTLN
DVESGSARRL*

Other information
Ka divergence:-0.358054KaKs divergence:-0.346756
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1104Length 2 (bp):933Length divergence:-0.084
MFE 1 (kcal):-342.3MFE 2 (kcal):-310.03MFE divergence-0.049