Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024668-GRMZM2G012631
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):HSP protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
QPELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG
QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLK
DDQLEYLEERRLKDLIKKHSEFISYPISLWIEKTTEKEISDDEDEEDKKDEEGKVEDVDE
KEEKEKKKKKIKEVSHEWQLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVKHF
SVEGQLEFKAVLFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPE*

MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKTKLDA
QPELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG
QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVARDTSGEQLGRGTKMTLYLK
DDQLEYLEERRLKDLIKKHSEFISYPISLWIEKTTEKEISDDEDEEDKKDEEGKVEDVDD
EKEEKEKKKKKIKEVSHEWQLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVKH
FSVEGQLEFKAVLFVPKRAPFDLFDTRKKQNNIKLYVRRVFIMDNCEELIPEWLSFVKGI
VDSEDLPLNISRETLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKLG
IHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIFYITGESKKAVENSPFL
EKLKKRGYEVLFMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKF
EGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYM
SSKKTMEINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRI
HRMLKLGLSIDEDEEAPEADTDMPPLEDDAGESKMEEVD*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):53GC content divergence:0.029
Length 1 (bp):1056Length 2 (bp):2100Length divergence:0.331
MFE 1 (kcal):-363.71MFE 2 (kcal):-792.55MFE divergence0.371