Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024708-GRMZM2G062156
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100273244

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.44331900367397
Log2 mRNA fold difference:1.8197608750259
Log2 TE fold difference:-2.269066662971
Sequences
Protein sequence

MASDELAKVVEPRKKGNVKYASICAILASMASVILGYDIGVMSGAAMYIKKDLRITDVQL
EILIGILSLYSLFGSFAGARTSDRIGRRLTVVFAAVIFFAGSLLMGFAVNYGMLMAGRFV
AGVGVGYGGMIAPVYTAEISPAASRGFLTTFPEVFINIGILLGYVSNFAFARLPLHLGWR
VMLAIGAVPSALLALLVFCMPESPRWLVLKGRLADARVVLERTSATPEEAAARLADIKAA
AGIPRDLDGDVVAVPNKGRDGGSSETQVWKQLILSPTPAVRRILLSAVGLHFFQQASGSD
SVVQYSARLFKSAGITDDNKLLGVTCAVGVTKTFFILVATFLLDRAGRRPLLLASTGGMI
VSLLSLGAGLTVAGHHPDGKVAWAVALCIASTLAYIAFFSIGLGPITGVYTSEIFPLRVR
ALGFAVGVASNRVTSAVISMTFLSLSKGITIGGSFFLYAGIAAVAWVFFFTCLPETRGRT
LEEMGKLFGMPDTDDMAEAEDATAGKEKVAEVEMYMPSKM*

MASADLAEAIEPSRKKKSNVKYASICAILASMASVILGYDIGVMSGAAMYIKKDLKITDV
QLEILIGILSLYSLIGSFAGARTSDRIGRRLTVVFAAVIFFAGALLMGFAVNYSMLMVGR
FVAGVGVGYGGMIAPVYTAEISPAASRGFLTSFPEVFINVGILLGYLSNFAFARLPLRLG
WRVMLGIGAAPAGLLALMVLWMPESPRWLVMKGRLADARAVLEKTSASPEEAAERLADIK
VAAGIPKGLDGDVVAVPKERSGGEMQVWRELILSPTPAIRRILLSAVGLHFFQQASGSDS
VVLYSPTVFKSAGITDDNKLLGVTCAVGVAKTLFILVATFLLDRAGRRPLLLTSTGGMIV
SLVGLGTGLTVVGHHPDAKIPSAVALCIASTLAYVAFFSIGLGPVTGVYNSEIFPLQVRA
LGFAVGVACNRVTSAVISMTFLSLSKGITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTL
EEMGKLFGMPDTDMAEAHNAAAKEKAVEMPAVLGND*

Other information
Ka divergence:-0.223174KaKs divergence:0.142716
GC content 1 (%):67GC content 2 (%):65GC content divergence:-0.015
Length 1 (bp):1563Length 2 (bp):1551Length divergence:-0.004
MFE 1 (kcal):-778.64MFE 2 (kcal):-733.14MFE divergence-0.03