Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G024738-GRMZM2G025031
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100192850
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7899033494623
Log2 mRNA fold difference:0.2463417090277
Log2 TE fold difference:-2.0393924514804
Sequences
Protein sequence

MMLPTATATAVFLTAAPSSFSTRRRRSRAIFASLSPSFSSSEEPLLVRAARGEDGLPRPP
AWMMRQAGRYMAEYQALAKRHPSFRERSENTDLIVEITLQPWRAFAPDGVILFSDILTPL
PAIGVPFDISDSKGPVIQSPVRSKEQVRELVPIDLDMLQFVGESLKILRNEIDGKAALLG
FVGAPWTIATYIVEGGMTNTYTNIKSMCHTAPDVLKGLLSHLAQAISDYIIYQVNSGAQC
IQIFDSWGGQLPPHVWEQWSKPYIKQIVSRIKKECPNVPLVLYINGNGGLLERMKNTGAD
VIGLDWTVDMTDGRRRLGNGISVQGNVDPAFLFSPLPVLTDEIHRVVKAAGPKGHILNLG
HGVLQKTPEEAVAHFFDVTRRLRYDTLFQGSVAEELHHVA*

MTNTYTNIKSMCHTAPDVLKGLLSHLAQAISDYIIYQVNSGAQCIQIFDSWGGQLPPHVW
EQWSKPYIKQIVSRIKKECPNVPLVLYINGNGGLLERMKNTGVDVIGLDWTVDMTDGRRR
LGNGISVQGNVDPAFLFSPLPVLTDEIHRVVKAAGPKGHILNLGHGVLQKTPEEAVAHFF
DVTRRLRYDTLFQGSVAEELHHVA*

Other information
Ka divergence:-1KaKs divergence:0.833927
GC content 1 (%):53GC content 2 (%):43GC content divergence:-0.104
Length 1 (bp):1203Length 2 (bp):615Length divergence:-0.323
MFE 1 (kcal):-448.9MFE 2 (kcal):-175.42MFE divergence-0.438