Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G025042-GRMZM2G001805
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191815
Function (paralog2):hypothetical protein LOC100192614

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MACRALALRSLLLPDPLHRLPAAAPPVWRASRGGRRPHLRCCSGGGGGEPGQPPQEAVLE
AISKIARSKGRVALTTNMVMGGTVTDDASDEWLVLDQKVNSYPTDRGFTAIGTGGDDFVQ
SMVVAVESVLQESIPKGRVSQKLSSRGKYVSVNIGPIRVVSSEQVQAVYRAMRRDNRMKY
FL*

MACRALALRFLLLPDPLHRLPATPPSVGRASGSRGGRRPHLRCSSGGGGGEPGQPPQEAV
LEAISKIARSKGRVALTTNVVMGGTVMDDASDEWLALDQKVNSYPTDRGFTAIGIGGDDF
VQSMVVAVESVLQESIPKGRVSQKLSSGGKYVSVKIGPIRVVSSEQVQAVYRAMRRDNRM
KYFL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):549Length 2 (bp):555Length divergence:0.005
MFE 1 (kcal):-194.41MFE 2 (kcal):-205.97MFE divergence0.029