Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G025074-GRMZM2G080889
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1631571459115
Log2 mRNA fold difference:0.85459825800475
Log2 TE fold difference:-2.0143933770012
Sequences
Protein sequence

MGDLKEVFRSLKELFPEVDHRILKAIAVEHRKDVDSAVVTVLDEVMPSMTGSAGTLFTHK
EVLPSMDDSVGNLFANRSTHEVGSSSCAGHEIHIDEIDVSVHPAQHTSSGEAKTGKQENI
NNECVGRLASVEGVSEQLNLHSDPIPNGSQHDLIPNLDVLSSNTNPEKMLANIYNEVGYS
GLSSECFSQQLTGKHGGDIIAPQSHDQDPNKMLPVGDYFSQNSSMEFFSGYEDMHFDGDL
LPPGSNDKVSSGILGTEKDSSVPVLDVPGRNKEESPAGTSGFIEQKDTSNVTNMLPDLNL
YHLASTASTHSSHSVSIESLEDSVADARSNKNDLLPSLELVTKMIEDVELLEEKAKVAKR
ESSVAGTGILTKVEELREMLTHAKEANDMHAGEVFGEKAILTTEARELQSRLQRLSDERN
KYLVIIEEIRQTLDQRLVAAQQEIAAAEKEKLEKEVAAQTLLNEQENMMNSIVEESRKLQ
KEAEENLKLKEFLVERSQIVDMLQGEMTGICEDVSLLKRVVDERLSLSKLQPSAMSSLSS
SLHSSHHKSWTSSDRTTEANGSLDKHTLAEPASPARKDLNGDECTVQVSDGNDTGKGVLK
RVDSKDGDGWELC*

MGDLKEVFRSLQELFPEVDHRILKAIAIEHRKDVDSAVVTVLDEVMPFMTGSAGVDGSVG
NLSSMDGSVGNLFGNHSTHEVGSSSSVWRDICINEIDASVYSVQYTSYGDVKTGKQENIN
NTYVGRLASIEGVNEQLNLHSYPIPNGGQHDLLPNLDVLSSNTDPEKTLANTDNEVGYSG
LFSECFSQPPTGEDGGNIIAPQPCDQDPNGMIPVGDYFPQNSSMEFFSGYEDYNFDDGLL
PIGSNDQISFRILGTEKDPFAPVLDVPGRDKEESSTETSGFIESSNNVADMLPDLNLNHF
TSTASTHSNHSVSIESLEDSVADARSNKNDLLPSIELVTKMIEDVELLEEKAKVAKHELS
VAGTGILAKVEELREMITYAKEANDMHAGKVLGEKAILTTEARELLSRHQRLSDERNKYL
VIIEEIHQILAERLVAAQQEIAAAEKENAEKEAAAQAVLDEQEKMMNSIVEESRKLQKEA
EENLKLKEFLVERGQIVDMLQGEMAVTCEDVSLLKRVVDERLPLSKLQRSAMSSLSSSLH
SSHHKSWTSSDKAIRSPDKHTLAEPASPVGKDLDGNECTVEVSDGNDSGEGILKRVDSKE
DVDGWELC*

Other information
Ka divergence:0.0898159KaKs divergence:-0.209143
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1842Length 2 (bp):1827Length divergence:-0.004
MFE 1 (kcal):-568.57MFE 2 (kcal):-567.29MFE divergence-0.001