Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G025123-GRMZM2G093254
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100279882

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.38364147677057
Log2 mRNA fold difference:-0.14735499989735
Log2 TE fold difference:-0.23857069297632
Sequences
Protein sequence

MGSAGALLWHTPQQLHGRGILFRQSRPLLRQRNLPLISLAAPALEPERRRRQCLRCAAVD
GDGALRESGPLPQKESPSSGIGAALEDPPPGPPVENGSFGGPSQEEQSALYTFLYPSKDL
LPDDKEMSIFDHLEELRDRIFISVLAVGAAILGCFAFSKDLVIFLEAPVTAQGVRFLQLS
PGEFFFTTLKVSGYCGLLLGSPIILYEIIAFVIPGLTRDERKFLGPIVLGSSVLFYLGIF
FSYTVLSPAALNFFVNYADGAVESLWSIDQYFEFILVLMFSTGLSFQVPVIQLLLGQLGL
VSSDQMLSIWRYVVVGAVVAAAVLTPSTDPLTQMLLAGPLLGLYLGGAWMVKITGR*

MGSTGALLWHPSPQVHSGGVLFRQSRRIVRQRNLPLLSLADAALEPERRRGQRLRCAAGD
GDGGPREAQKESPSGIGAALEDPSPGPPVENGSFRSPSQEEQSALYNFLYPSKDLLPDDK
EMSIFDHLEELRERIFISVLAVGAAILGCFAFSKDLVLFLEAPVTVQGVRFLQLSPGEFF
FTTLKVSGYCGLLLGSPIILYEIIAFVIPGLTRDERKFLGPIVLGSSVLFYLGIFFSYTV
LSPAALNFFVNYADGAVESLWSIDQYFEFILVLMFSTGLSFQVPVIQLLLGQLGLVSSDQ
MLSIWRYVVVGAVVAAAVLTPSTDPLTQMLLAGPLLGLYLGGAWMVKLTGR*

Other information
Ka divergence:-0.186054KaKs divergence:-0.443954
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1071Length 2 (bp):1056Length divergence:-0.007
MFE 1 (kcal):-401.2MFE 2 (kcal):-407.02MFE divergence0.007