Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G025281-GRMZM2G077823
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383636
Function (paralog2):hypothetical protein LOC100272627

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.50634695315112
Log2 mRNA fold difference:-1.191260878616
Log2 TE fold difference:1.7055931264974
Sequences
Protein sequence

MSRFGRSGPPPPIRDTYSLLVLNITFRTTADDLFPLFDKYGEIVDIYIPRDRRTGDSRGF
AFVRYKYEDEAQKAVERLDGRLVDGREIMVQFAKYGPNAERINKGRIVEPVPRPGGRSRS
HSPRRRYRDDYRDDHDRDYRRRSRSRSRDRYTRDRYRDRDYRHRSPSRSYSPDDYKKRGR
DSLSPERRSPRRSRSPDDYKRRGRDSASPASKSPSRSPPRKMSPSPERSPVRRNNDRSPR
SRSPST*

MSRFGRSGPPPPIRDTYSLLVLNITFRTTADDLFPLFDKYGEIVDIYIPRDRRTGDSRGF
AFVRYKYEDEAQKAVDRLDGRLVDGREIMVQFAKYGPNAERINKGRIMEPVPRPRGRSRS
RSPRRRYRDDYRDDYQDRDYRRRSRSQSRDRYARDRYRDRDYRHRSLSRRYSPDDYKKRG
RDSLSPARRSPSHSRSRSYTPDDYKRRGKDSASPASRSPSRSPPRKTPPSPKRSPVRHND
DRSPRSRSPST*

Other information
Ka divergence:0.035982KaKs divergence:0.222244
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):741Length 2 (bp):756Length divergence:0.01
MFE 1 (kcal):-243.7MFE 2 (kcal):-249.7MFE divergence0.012