Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G025414-GRMZM2G061396
Species:maize
Duplication type:WGD
Function (paralog1):BCL-2 binding anthanogene-1
Function (paralog2):LOC100284773

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.3729871764111
Log2 mRNA fold difference:-2.3932246683155
Log2 TE fold difference:0.14144247741102
Sequences
Protein sequence

MVKIPSPRRLFRSRSRSTTIIGGGGADICAMVAEHERIEWEVRPGGMLVQKRRSTEDDAA
AAVEYILVRVSTTGWQWHDVSIDATATFGDLKVMLSLATGLWPREQRLLYRGKERDDCEH
LHMVGVQDKDKVLLLEDPAVKERKLRSTTLAQLMGVPCHSFIQV*

MVKIPSPSRLFRSRSRSSTTIGGAGADICAMVAEHEKIEWEVRPGGMLVQRRRPSPEDDA
AAAVDVEYILVKVSTGWQWHDVSIDAIATFGDLKVTLSLVTGLWPREQRLLYRGKERDDR
EHLHMVGVQDRDKVLLLEDPAVKERKLRSTTLAQLMGVPCHSFIQV*

Other information
Ka divergence:0.390601KaKs divergence:0.495252
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):495Length 2 (bp):501Length divergence:0.006
MFE 1 (kcal):-234.5MFE 2 (kcal):-244.5MFE divergence0.021