Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G025648-GRMZM2G089974
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193818
Function (paralog2):hypothetical protein LOC100273166

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.3766162006422
Log2 mRNA fold difference:-1.2088256365925
Log2 TE fold difference:0.81410099860948
Sequences
Protein sequence

MSLLASPTPFGVTAIRRRVAPLPLLPAGGRAALHVALARRGGVSSRTQRRLEERGGKKRR
GGVVAPDVDEDAAEAGVAEWEGEPLGFEVSTEPMPRLPDPETPDFWEGPQWEALGFFVQY
MWAFGVVFGLIACGVAVATYNDGATDFKDTPAYKESQSQEFPEESESSSADVFEGNPTEV
APALE*

MALLASPTPFGAAAIRRRVAPLALIPAGGRAALHVALARRGGVSSRTQRRLEERGGKKRR
GGVAAPDVDEDAAEAGTAAEWEGEPLGFEVSTEPMPELPNPEKPDFWEGPQWEALGFFVQ
YMWAFGVVFGLIACGVAVATYNDGATDFRDTPAYKESQSQEFPEESESSSADVFEGNPTE
VAPALE*

Other information
Ka divergence:0.273714KaKs divergence:0.176054
GC content 1 (%):67GC content 2 (%):69GC content divergence:0.015
Length 1 (bp):558Length 2 (bp):561Length divergence:0.003
MFE 1 (kcal):-274.5MFE 2 (kcal):-288.6MFE divergence0.025