Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G025731-GRMZM2G044900
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272896
Function (paralog2):hypothetical protein LOC100383346

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.57473559463069
Log2 mRNA fold difference:-1.6652557623212
Log2 TE fold difference:1.0926342915938
Sequences
Protein sequence

MPTAYSLRAPPSASQQRLRLPLPPPPPPLPFCPGGGAARRRRGVGVASASASPFDELHAR
GRPVHGPSKKSMLWNLIQDIEPLDLSVIQKDVAPETVDAMKRTISGMLGLLPSDQFRVIV
EALWNPFFKLLVSSIMTGYTLRNAEYRLSFERNLELPEEGVECLKSDVTEDNHHNINLGR
PVTIFRLSEEDMPQDPGKTDEASSYENMGEELGDLTPQAEEYIIQMQSHLNAMKKELHDL
RRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELSESTSPGVQETIHSVVHGLLATLSP
KVHSKAPPPLDNISGGVLNLGGEDDDRAELVENASLPFQPLISVPRDYLARLLFWCMLLG
HYIRGLEYRLELARLLRISSVGSFSGGDDHVV*

MPTAYSLRAPPSTAQQRLRLPPPPLPLCPAGGGAARRRRVVGVASASASPFDELYARGRP
AHGPSKKSMLWNLIQDIEPLDLSVIQKDVAPETVDAMKRTISGMLGLLPSDQFRVIVEAL
WNPFFKLLVSSIMTGYTLRNAEYRLSFERNLELSEEVAECQKSDVIEDNHHDINLGTPVT
IFRLAEEDMPQDPEKTDDESSYENMGEELGDLTLQAEEYIIQMQSRLDAMKKELHDLRRK
NSALQMQRFVGEEKNDLLDYLRSLTPEKVAELSESSCPGVQEAIHSVVHGLLATLSPKIH
SKAPPPLDNTSGGVLNLGGEDDDCAELVENASLPFQPLISVPRDYLARLLFWYCEADLIG
IVMFIYHVATEHRHFQLFRCMLLGHYIRGLEYRLELAQLLRISSDVGSFSGGDDHVV*

Other information
Ka divergence:-0.0273046KaKs divergence:0.0273782
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1179Length 2 (bp):1254Length divergence:0.031
MFE 1 (kcal):-407.61MFE 2 (kcal):-434.82MFE divergence0.032