Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G025832-GRMZM2G313750
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273383
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5220554690772
Log2 mRNA fold difference:0.31399841543411
Log2 TE fold difference:-2.2949969228509
Sequences
Protein sequence

MDVPLPLLLGSVAVSLVVWCLLLRRGGAGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMC
AMAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYQDLVF
APYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARQGERGRAAVALGQVAN
VCATNTLARATVGRRVFAVDGGEGAREFKEMVVELMQLAGVFNVGDFVPALAWLDPQGVV
GRMKRLHRRYDDMMNGIIRERKAAEEGKDLLSVLLARMREQQPLAEGDDTRFNETDIKAL
LLNLFTAGTDTTSSTVEWALAELIRHPDVLRKAQQELDAVVGRDRLVSESDLPRLTYLTA
VIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLEFRPA
RFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDWDLADGMT
ADKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYAE*

MDVPLPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMC
ALAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVF
APYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARPRRGEGGRAAAVALGQ
VANVCATNTLARATVGRRVFAVDGGEGAREFKEMVVELMQLAGVFNVGDFVPALAWLDPQ
GVVGRMKRLHRRYDHMMNGIIRERKAAEEGKDLLSVLLARMRDQQQQPLAEGEDNRINET
DVKALLLPLPTAPTPALQLPPRRMLPNALYNPGESRDGRMTVRVVMRYLVNKLGLEDDSQ
HRLTKHLGEPHKAQATSHLLESRESYRQMANCGLWELEKQATNCSGALRAGKESACDAEV
VRPLSKLPNSSIGLYDSSFECDACGVGFVAELSGDYKHVTVNDTIEMLERMAHRGACGCE
KNTGDGAGIMVALPHDFFKEVAKDAGIELPPLGEYAVAMFFMPTDEKRRKKGKAEFKKVA
ESLGHVILGWRLVPTDNSDLGESALETEPVIEQRRRLTCSISFIVLFYKGFNTIRATVGM
LLGRRGHAQVPGALPVDGPRRPHPQSRRATDRVQLLQDVRIPYQQKRMFGFVTFVYAETV
KVILSKGNPHFVCDARVLVKPYKEKGKVPGRFRKLQHTHHGGAEFVGCASPTGLLDSRDP
YALLLLSGAQNLFTAGTDTTSSTVEWALAELIRHPDVLRKAQQELDAVVGRDRLVSESDL
PRLTYLTAVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWP
EPLQFRPARFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALE
WDLADGVTAEKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYAAQ*

Other information
Ka divergence:0.0472385KaKs divergence:0.0672269
GC content 1 (%):70GC content 2 (%):64GC content divergence:-0.045
Length 1 (bp):1548Length 2 (bp):2835Length divergence:0.294
MFE 1 (kcal):-817.1MFE 2 (kcal):-1405.83MFE divergence0.265