Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G026085-GRMZM2G306781
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277796
Function (paralog2):hypothetical protein LOC100277318

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.70068981587554
Log2 mRNA fold difference:0.96416664246012
Log2 TE fold difference:-0.22628639560083
Sequences
Protein sequence

MASHLDFRCLDEGLGGERGKRKRREDASAAAADSMDLDADAPRPSKLRAMPSLSDPSKPA
SFGQPTYDGVIAGRLSGRRWKEPRTRRSSAVAVSRKPIPLEQRVREKSLKRAYQARKAEL
KEEIRQNKVAKRKAREEREKRKQENVLRTGTKLQRVTNPKTIQKIAKSKKRKQLKVVPDE
FFGGKKSEASRRMQVPGLEN*

MASHIDFRCLDEGLGGERGKRKRREDAEAAAADSMDLDADAHRPSKLRAMPSLSDPSKPA
SFGQPTYDGVIAGRLSGRRWKEARTRRASAVAVSRKPTPLEQRVREKSLKRAYQARKAEL
KEEIRQNKVAKRKAREEREKRKQENVLRTGTKLQRVTNPKTIQKIAKSKKRKQLKVVPDE
FLGGKKSVANRRMQVPGLEN*

Other information
Ka divergence:-0.0396677KaKs divergence:-0.188225
GC content 1 (%):68GC content 2 (%):67GC content divergence:-0.007
Length 1 (bp):603Length 2 (bp):603Length divergence:0
MFE 1 (kcal):-289.84MFE 2 (kcal):-281.7MFE divergence-0.014