Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G026371-GRMZM2G156158
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100279341

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-4.3666419815065
Log2 mRNA fold difference:-3.2458542002719
Log2 TE fold difference:-1.11668912086
Sequences
Protein sequence

MASGDLLLRAHAGAPVLARAFSCRLLVPARRRSGLISPLAASKVGIADVVGRVRSGGADQ
KRRRRDAKEGFGFSGVATRRELIDDEKVEQDEEDEALKLGVEKNGGETGGVDGSYLSETR
FDQCAISPLSMKAVKDAGYERMTEVQEATLPIILQGKDVLAKAKTGTGKTVAFLLPAIEV
LSTLPHQRGQLRPPINLLVMCPTRELANQVAVEARKLLRYHRTLGVQVVIGGTRLTQEQR
SMQANPCQILVATPGRLKDHLENTPGFSTRLKGVKVLVLDEADRLLDMGFRRDIEKIIAS
IPRERQTLLFSATVPEEVRQISHVAMKKDYRFINTVKEGDEETHAQVSQMYMVAPLDLHF
SILYDVLKKHVAEDADYKVIIFCTTAMVTKLVAEVLSQLKLNIREIHSRKSQSARTKVSD
EFRKSKGLILVSSDVSARGVDYPDVTLVIQVGVPADREQYIHRLGRTGRKGKEGQGLLLL
APWEKYFLGAVKDLSIAESAVPPVDSSVETEVSSMHYLFSTWLSDSVRNAVRKVEMKSKE
CAYQAWLGYYNSNKTIGRDKSRLVHLAEEFSQSMGLAVPPAIPRNILRKMGLNNVPGLRS
S*

MSTSANPKLKRRRGGLRKQGPGYPTVATTGAMFAHEVGAEGPRRDTRQGPALPRVVATST
RGGGAIEQGADGMEGSASKTDRSVHEAVGVDGTYLTETRFDQCAISPLSLKAIKDAGYER
MTRVQEATLPIILQGKDVLAKAKTGTGKTVAFLLPAIEVLSALPRSTSINLLVMCPTREL
ANQLAAEARKLLKYHRSLGVQVVIGGTRLPQEQRSMQANPCQILVATPGRLKDHLENTPG
FSTRIRGVKVLVLDEADRLLDMGFRRDIEKIITFIPKDRQTLLFSATVSEEIHQISHLAM
RKDYDFINAVQEGDEETHAQVNQTYMVAPLGLHLPILYDVLKKHVAEDAEYKVIVFCTTA
MVTRLVAEVLSQLKLNIREIHSRKTQSARTKVSDEFRKSKGLILVSSDVSARGVDYPDVT
LVMQVGLPADREQYIHRLGRTGRKGKEGQGILLLAPWEMHFLSTVNDLSISEAATPSVDS
SIQAAVKDAVRRVEMKSKESAYQAWLGYYNSHKATNRDKARLVMLAEEFSQSIGLAVPPA
IPKQILRKMGLSNVPGLRSS*

Other information
Ka divergence:0.257576KaKs divergence:-0.16708
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1806Length 2 (bp):1683Length divergence:-0.035
MFE 1 (kcal):-618.2MFE 2 (kcal):-573.2MFE divergence-0.038