Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G026417-GRMZM2G030458
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275086
Function (paralog2):hypothetical protein LOC100278142

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.19684836888802
Log2 mRNA fold difference:-0.26071199976778
Log2 TE fold difference:0.45603886440594
Sequences
Protein sequence

MFPTVDDPSAAGAMVSASFPDADAYGNGDSDDLDFPVDPNPNPVFSSPAAPASAGAAGER
RPLFQRLWTDEDEIVILRAFAEFTAQRGTAFASHQYDTTPFYEDMRRRLNTGFTKNQLVE
KIRRLKRKYRNCVERLRVAGAGFNFRSPHEQAIFEIARTIWRPASDKHGRDSDDEGGGGG
NNAHDATFAMDAATFAIDAALAAANGGSAKSPTSRPRRGRRRRTGDFPADAVPETTLALP
PAPMPVMTEDVLPSFPQVTAAAVMDGGCGVSVDPASGLPAALSTAAAAAAVSGSSTAENP
ILAALFKEMVHAMLSVGVGGSTALLGLEPPPPIAGVPMEGEKWRQQRIQELEVYLRRIDL
LQDQARAALDELRSAPHAGGMNT*

MFPTVDEPSAAGAMVSSSFPDADAYGNGDSDGLDFPVDPNPNPVFSSPAAAAAPGSAGAA
GERRQLFQRLWTDEDEIVILRAFAEFTAQRGTSFASHQYDTTPFYEDMRRRLNTGFTKNQ
LAEKIRRLKRKYRNCVERLRVAGSGFTFRSPHEQAIFEIARTIWRPASDKHGRDSDDEGG
GGNVHDATFAPFAIDAAANGESAKSSRPRRGRRRRTGDFPADAVALPPAPMPMQVMTEDA
LPSFPQATAAAVMNGGCGLIVDPASGLPTALSSAAAAATAVSGGSTTENPILTALFKEMV
RAMLSVVGSGGGTTALQGLEPPPPIAGVPMEGEKWRQQRIRELEVYLRRMDLLQDQARAA
LEELRSAPHAGGMNT*

Other information
Ka divergence:0.431333KaKs divergence:0.664841
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1152Length 2 (bp):1128Length divergence:-0.011
MFE 1 (kcal):-577.2MFE 2 (kcal):-584.52MFE divergence0.006