Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G026807-GRMZM2G178960
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274365
Function (paralog2):ribulose-phosphate 3-epimerase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.22603614378803
Log2 mRNA fold difference:0.13249523062781
Log2 TE fold difference:0.11149672912781
Sequences
Protein sequence

MATPSSSLCSSFASLRTASIGHPRGIASSTPRKAFHVRASARVDKFSKSDIIVSPSILSA
NFAKLGDQVKAVEVAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEP
EQRVPDFIKAGADIVSVHCEQTSTIHLHRTVNQIKSLGAKAGVVLNPATPLTAIDYVLDV
VDLVLIMSVNPGFGGQSFIESQVKKIAELRRLCAEKGVNPWIEVDGGVGPKNAYKVIEAG
ANAIVAGSAVFGAPDYAEAIKGIKTSQRPLAVAA*

MATPSSSLCSSFASLRTASIGHPRGIASSTPRKAFQVRASARVDKFSKSDIIVSPSILSA
NFAKLGDQVKAVEVAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEP
EQRVPDFIKAGADIVSVHCEQTSTIHLHRTVNQIKSLGAKAGVVLNPATPLNAIDYILDV
VDLVLIMSVNPGFGGQSFIESQVRKIAELRRLCAEKGVNPWIEVDGGVGPKNAYKVIEAG
ANAIVAGSAVFGAPDYAEAIKGIKTSQRPAAVHA*

Other information
Ka divergence:0.205139KaKs divergence:0.201826
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):825Length 2 (bp):825Length divergence:0
MFE 1 (kcal):-285MFE 2 (kcal):-278.22MFE divergence-0.012