Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G026910-AC233939.1
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284567
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAPGDDSNPAASYIHTVQHLIERCMTFGMSMEECMEALAKRADVLPVVTSTVWKELEKEN
KEFFDKYQEWISEKRSAGTS*

MPQRHSKNNNDLAFFTYEEKRKLGYGTQRERLGKDSIKPFDACCLCLKPLIGPLCCPKGH
TFCKECILECLLSQKKDIKRKLAAHEAQKKQEKEEEEEKLILQKAKELDAFDQQNHGAVP
QYHDRSGSQYKNGFHGANSVKVTSFEEEALRNMKAFWLPSATPEATVKVDLPSTDTVCPE
GQEKLKLKSLFPISFTEETADQKSSKAGNSCSYMCPSCKSTLTNTMSLVAVSTCGHVFCK
KCSDKFLVKDKACLECSKPFRERNLVPLEKGGTGFAAHDERLEARDFKYLGSGSGLGLVK
PAPKTY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):52GC content divergence:-0.063
Length 1 (bp):243Length 2 (bp):921Length divergence:0.582
MFE 1 (kcal):-97MFE 2 (kcal):-334.6MFE divergence0.551