Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G026930-GRMZM2G013726
Species:maize
Duplication type:WGD
Function (paralog1):Dihydroflavonol-4-reductase (DFR)(EC 1.1.1.219)(Dihydrokaempferol 4-reductase)
Function (paralog2):hypothetical protein LOC100272982

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEGGAGASEKGKVLVTGASGFVGSWLVMKLLQAGYTVRATVRDPANVGKTKPLMDLPGAT
ERLSIWKADLAEEGSFHDAIRGCTGVFHVATPMDFLSKDPENEVIKPTVEGMISIMRACK
EAGTVRRIVFTSSAGTVNLEERQRPVYDEESWTDVDFCRRVKMTGWMYFVSKTLAEKAAL
AYAAEHGLDLVTIIPTLVVGPFISASMPPSLITALALITGNAPHYSILKQVQLIHLDDLC
DAEIFLFENPAAAGRYVCSSHDVTIHGLAAMLRDRYPEYDVPQRFPGIQDDLQPVRFSSK
KLQDLGFTFRYKTLEDMFDAAIRTCQEKGLIPLATAAGGDGFASVRAPGETEATIGA*

MRDVVAKREAMKGGASSKGPVVVTGASGFVGSWLVMKLLQAGYTVRATVRDPENVGKTKP
LLDLPGATERLSIWKADLADEDSFDEAIRGCTGVFHVATPTDFESKDPENEVIKPTVEGM
IRILRACKEAGTVRRIVFTSSAGTVCVEERQRPVYDHDNWSDVDFCRRVKMTGWMYFVSK
SLAEKAAVAYAAEHGLDLVSVIPTLVVGPFLSAAMPPSLVTALALVTGNEAHYSILKQVQ
FVHLDDLCDAEIFLFEHPAAAGRYVCSSHDATIHGLAAMLRDRYPEYDIPQKLRGIEDEL
QLVHFSSKKLLDHGFTFRYTVEDMFDAGIRTCREKGLIPLATAGGVGSASLRTPGETARR
M*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):65GC content divergence:0
Length 1 (bp):1074Length 2 (bp):1086Length divergence:0.006
MFE 1 (kcal):-473.1MFE 2 (kcal):-490.61MFE divergence0.018