Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G027378-GRMZM2G071010
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized proteinUbiquitin-conjugating enzyme spm2 ;
Function (paralog2):Putative uncharacterized proteinUbiquitin-conjugating enzyme spm2 ;

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.14861373833604
Log2 mRNA fold difference:0.22806525573784
Log2 TE fold difference:-0.12820080781795
Sequences
Protein sequence

MTLGSSGAGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDIYMRSWTGTIIGPHN
TVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGMVDPRKFGLLANWQRDYTM
ENILTQLKKEMAASQNRKLVQPPEGTFF*

MTLGSSGAGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDIYMRSWTGTIIGPHN
TVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGMVDPRKFGLLANWQRDYTM
ENILTQLKKEMAASQNRKLVQPPEGTFF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):447Length 2 (bp):447Length divergence:0
MFE 1 (kcal):-150.6MFE 2 (kcal):-146.2MFE divergence-0.015