Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G027439-GRMZM2G146346
Species:maize
Duplication type:WGD
Function (paralog1):BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1
Function (paralog2):hypothetical protein LOC100193532

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.2135889712618
Log2 mRNA fold difference:-2.9936801385147
Log2 TE fold difference:1.7160363354068
Sequences
Protein sequence

MSRHHHHAATIAAAVLFLLTAPPCAADPNDERCLTHLHQSLSDSSGRLNWTKAAISAPCD
GFFSHLQGVTCNNGRVYKLALPDLSLGGTVPPELSNCTNLQSLDLSANALSGAIPTELSA
LLNLAVLNLSANALSGAIPRELASCAYLNVIDLHGNQLSGPIPEELGLLVRLSTFDVSYN
RLSGPIPVLLANRSGAGTAAVGTARFNASSFVGNKGLYGYPLPPMRTRGLSVLAIVGIGL
GSGLLSLVLSFSAVCLWLRATDRRTPTTPGEEGKISQPMPNY*

MSRHHHFAAAIAVVLILFAPPPCAGDPNDERCLTHLHQSLSNPSGGLNWTKAAISAPCDG
FFSHLQGVTCNNGRVYKLALPELSLGGTVPPELSNCTNLQSLDLSANALSGAIPTELSAL
LNLAVLNLSANALSGAIPRELASCAYLNVIDLHGNQLSGPIPDELGLLVRLSAFDVSHNR
LSGPIPVLLANRTGAGTAAVGTARFNASSFVGNKGLYGYPLPPMRTRGLSVLAIAGIGLG
SGLLSLVLSFSAVCLWLRATDRTATISGEEGKISQLMPDY*

Other information
Ka divergence:0.0913931KaKs divergence:0.572023
GC content 1 (%):67GC content 2 (%):67GC content divergence:0
Length 1 (bp):849Length 2 (bp):843Length divergence:-0.004
MFE 1 (kcal):-341.36MFE 2 (kcal):-349.2MFE divergence0.011