Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G027451-GRMZM2G087233
Species:maize
Duplication type:WGD
Function (paralog1):60S ribosomal protein L10-3
Function (paralog2):60S ribosomal protein L10 (QM protein homolog)

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.57542894910913
Log2 mRNA fold difference:-0.22772468372358
Log2 TE fold difference:-0.34782669476551
Sequences
Protein sequence

MQWTFLLLWCIGIMLIDTQAFMFLKHWLGPARCYRQIKNKPYPKSRYCRGVPDPKIRIYD
VGMKRKGVDEFPYCVHLVSWEKENVSSEALEAARIACNKYMTKSAGKDAFHLRVRVHPFH
VLRINKMLSCAGADRLQTGMRGAFGKPQGTCARVDIGQVLLSVRCKDNNAAHASEALRRA
KFKFPGRQKIIESRKWGFTKFSRADYLKYKSEGRIVPDGVNAKLLGNHGRLEKRAPGKAF
LEAVA*

MGRRPARCYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPYCVHLVSWEKENV
SSEALEAARIACNKYMTKSAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMRGAFG
KPQGTCARVDIGQVLLSVRCKDNNAAHASEALRRAKFKFPGRQKIIESRKWGFTKFSRAD
YLKYKSEGRIVPDGVNAKLLGNHGRLEKRAPGKAFLDAVA*

Other information
Ka divergence:-0.610875KaKs divergence:-0.701493
GC content 1 (%):51GC content 2 (%):55GC content divergence:0.038
Length 1 (bp):738Length 2 (bp):663Length divergence:-0.054
MFE 1 (kcal):-262.92MFE 2 (kcal):-250.6MFE divergence-0.024