Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G027741-GRMZM2G054354
Species:maize
Duplication type:WGD
Function (paralog1):protein transporter
Function (paralog2):hypothetical protein LOC100194028

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.0554844968914
Log2 mRNA fold difference:-1.9354455756067
Log2 TE fold difference:-0.12454898630663
Sequences
Protein sequence

MSDNLMDKVSAFGERLKITGTEVSKKMTAGMSSMSFKMKELFQGQTPADKIVEGATSEDL
DGPDWNSNLEICDMINTEKVDSVELIRGIKKRIMLKDARVQYLSLVLLETIVKNCDKAFS
EVAAERVLDEMVRLIDDPQTVVNNRNKALMLIEAWGESGDELRYLPVYEETYKSLKSRGV
RFPGRDNESLAPIFTPARSVAEADVDASLPQQVFEDVHVHTYTAEETKEAFDVARNSVEL
LSTVLSSSPEQDALQDDLTTTLVQQCYQSQHTIQMIIETVGDNEAVLFEALSVNDEIQKV
LSKYEEMKQPRASEHAEHVPVVIPIAAEHEDLNAVGNEDALVRKPAAARATSGGDDDILD
DLDEMIFGKKGGSSSQEGPKKPDPKKDDLISF*

MKRNPRQKMSDNLMEKVSAFGERLKITGTEVSKKMTAGMSSMSFKMKELFQGQTPADKIV
EDATSENLDGPDWNSNLEICDLINTEKVNSVELIHGIKKRIMMKDARVQYLSLVLLETIV
KNCEKAFSEVAAERVLDEMVRLIDDPQTVVNNRNKALMLIEAWGESGDELRYLPVYEETY
KSLKSRVRFPGRDNESLAPIFTPPRSVAEADVETSLPQQAFEDVHVHTYTAEETKEAFDV
ARNSIELLSTVLSSSPEQDASQDDLTATLVQQCYQSQHTIQRIIETVGDNEAVLFEALSV
NDEIQKVLSKYEEMKQPRASEHAEQRAVVIPVATEHEDLTAAVNEDALVRKPAAARTRSG
GDDDILDDLDEMIFGKKGGSSSQEGPKKPDPKKDDLITF*

Other information
Ka divergence:-0.0651582KaKs divergence:-0.30968
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1179Length 2 (bp):1200Length divergence:0.009
MFE 1 (kcal):-397.91MFE 2 (kcal):-384.74MFE divergence-0.017